Comparison

Recombinant Human TNFSF15/TL1 Protein European Partner

Item no. RP00053-100ug
Manufacturer Abclonal
Amount 100 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 5 ug
Specific against Human (Homo sapiens)
Purity > 90% by SDS-PAGE.
NCBI TNFSF15
Alias TNFSF15,TL1,TL1A,TNLG1B,VEGI,VEGI192A
Available
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
20.47 kDa
Description
Recombinant Human TNFSF15/TL1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Leu72-Leu251) of human TL1A/TNFSF15 (Accession #NP_005109.2) fused with an initial Met at the N-terminus.
Background
The protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Leu72-Leu251
Route
No tag
Manufacturer - Research Area
Immune Checkpoint, TNF family
Antigen Seq
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 Protein at 5 μg/mL (100 μL/well) can bind DCR3 with a linear range of 0. 12-6. 98 ng/mL.|2. Measured by its ability to induce apoptosis of TF‑1 human erythroleukemic cells. The ED50 for this effect is 52. 1-208. 5 ng/mL, corresponding to a specific activity of 4. 79×103~1. 92×104 units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 50mM NaCl, 5% glycerol, pH 8.0.Contact us for customized product form or formulation.
Expected Protein Size
20.47 kDa
Gene Symbol
TNFSF15

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close