« Back
Home /
Recombinant Human IL-15RA/CD215 Protein

Recombinant Human IL-15RA/CD215 Protein

Item no.	RP01192-10ug
Manufacturer	Abclonal
Amount	10 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
NCBI	IL-15RA/CD215
Alias	IL15RA,CD215
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	48.40 kDa
Description	Recombinant Human IL-15RA/CD215 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Thr205) of human IL-15R alpha/CD215 (Accession #NP_002180.1) fused with a Fc, 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Met1-Thr205
Recommended Dilution	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Route	C-hFc&His
Manufacturer - Research Area	Bio-Markers & CD Antigens, Interleukin
Antigen Seq	MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized recombinant Human IL15 at 2 μg/mL (100 μL/well) can bind recombinant Human IL-15R alpha, the EC₅₀ of Human IL-15R alpha is 178. 9 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	48.40 kDa
Gene Symbol	IL-15RA/CD215

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01192-10ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/2/2025

Compare

Add to wishlist

Get an offer

Request delivery time