« Back
Home /
Recombinant Human CCL3/MIP-1 alpha Protein

Recombinant Human CCL3/MIP-1 alpha Protein

Item no.	RP01855-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Category	Oncology By Cell Type Carcinoma Hematology Lymphoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Autophagy
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
NCBI	CCL3/MIP-1 alpha
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CCL3,G0S19-1,MIP1A,SCYA3,C-C motif chemokine 3,G0/G1 switch regulatory protein 19-1,Macrophage inflammatory protein 1-alpha,MIP-1-alpha,PAT 464.1,SIS-beta,Small-inducible cytokine A3,Cleaved into: MIP-1-alpha(4-69),LD78-alpha(4-69)
Available
Manufacturer - Applications	< 1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	7.78 kDa
Description	Recombinant Human CCL3/MIP-1 alpha Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala23-Ala92 ) of Human CCL3/MIP-1 alpha (Accession #NP_002974.1) fused with no tag.
Background	CCL3 also known as macrophage inflammatory protein 1-a, is a member of the CC subfamily. It’s known that CCL3 is produced by monocytes/macrophages, lymphocytes, neutrophils as well as immune cells such as basophils, mast cells, fibroblasts, and dendritic cells. Meanwhile, CCL3 exerts various biological effects by binding to its three cell surface receptors, including CCR1, CCR3, and CCR5. MIP-1a induces a variety of pro-inflammatory activities such as leukocyte chemotaxis, and promotes the entry of T cells into the inflammatory tissue region from blood circulation. Chemotactic CD4+ cells, CD8+ cells, natural killer cells, and dendritic cells bind to the corresponding receptors and coordinate the occurrence of immune reactions in the immune response site by migrating through vascular endothelial cells. In addition, MIP-1a is considered as a key inflammatory mediator in granuloma, asthma, T1D as well as other autoimmune diseases.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala23-Ala92
Route	No-tag
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Manufacturer - Synonyms (full list)	CCL3, G0S19-1, MIP1A, SCYA3, C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1, Macrophage inflammatory protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible cytokine A3, Tonsillar lymphocyte LD78 alpha protein, Cleaved into: MIP-1-alpha(4-69), LD78-alpha(4-69)
Expected Protein Size	7.78 kDa
Gene Symbol	CCL3/MIP-1 alpha

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01855-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/27/2025

Compare

Add to wishlist

Get an offer

Request delivery time