« Back
Home /
Recombinant Human IL-9 Protein

Recombinant Human IL-9 Protein

Item no.	RP02891-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Category	Oncology By Cell Type Hematology Lymphoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
NCBI	IL9
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	P40,HP40,IL-9；IL9
Available
Manufacturer - Applications	<0.1EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	14.12 kDa
Description	Recombinant Human IL-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Ile144) of human IL9 (Accession #NP_000581.1) fused with and no tag.
Background	Interleukin 9, also known as IL-9, is a cytokine (cell signaling molecule) belonging to the group of interleukins. IL-9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Gln19-Ile144
Route	NO-tag
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Bioactivity	Measured in a cell proliferation assay using M07e human megakaryocytic leukemic cells. The ED50 for this effect is 0. 28-1. 12 ng/mL, corresponding to a specific activity of 8. 9×10⁵~3. 6×10⁶ units/mg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size	14.12 kDa
Gene Symbol	IL9

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP02891-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer