Vergleich

Timm29 Rabbit pAb Europäischer Partner

ArtNr A20812-20ul
Hersteller Abclonal
Menge 20 ul
Quantity options 1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IP, ELISA
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence YLQPRWVDFPGRILDVGFVGRWWILQNRMHDCDINDDEFLHLPAHLRVVAPHQLHSEANERLFEEKYKPIILTDDQVDQALWEEQVLQKERKDRLALSEADSLVQSDVSR
NCBI Timm29
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias TIM29, 1810026J23Rik, Timm29
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
Predicted to enable protein transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Predicted to be located in mitochondrial inner membrane and mitochondrial intermembrane space. Predicted to be part of TIM22 mitochondrial import inner membrane insertion complex. Orthologous to human TIMM29 (translocase of inner mitochondrial membrane 29).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 157-266 of mouse Timm29 (NP_848734.1).
Recommended Dilution
WB, 1:500 - 1:1000|IP, 1:500 - 1:1000
Protein Size
29kDa
Route
Recombinant protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen