Comparison

Timm29 Rabbit pAb European Partner

Item no. A20812-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Category
Type Antibody Polyclonal
Applications WB, IP, ELISA
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence YLQPRWVDFPGRILDVGFVGRWWILQNRMHDCDINDDEFLHLPAHLRVVAPHQLHSEANERLFEEKYKPIILTDDQVDQALWEEQVLQKERKDRLALSEADSLVQSDVSR
NCBI Timm29
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias TIM29, 1810026J23Rik, Timm29
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
Predicted to enable protein transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Predicted to be located in mitochondrial inner membrane and mitochondrial intermembrane space. Predicted to be part of TIM22 mitochondrial import inner membrane insertion complex. Orthologous to human TIMM29 (translocase of inner mitochondrial membrane 29).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 157-266 of mouse Timm29 (NP_848734.1).
Recommended Dilution
WB, 1:500 - 1:1000|IP, 1:500 - 1:1000
Protein Size
29kDa
Route
Recombinant protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close