« Back
Home /
MT-ND5 Rabbit pAb

MT-ND5 Rabbit pAb

Item no.	A8135-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	IALELNNLTMKLSMNKANPYSSFSTLLGFFPSIIHRITPMKSLNLSLKTSLTLLDLIWLEKTIPKSTSTLHTNMTTLTTNQKGLIKLYFMSFLINIILIIILYSINLE
NCBI	mt-Nd5
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ND5, MT-ND5
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background	Contributes to NADH dehydrogenase (ubiquinone) activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, NADH to ubiquinone; and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Is expressed in central nervous system; heart; liver; metanephros; and retina. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Leigh disease; and MELAS syndrome. Orthologous to human MT-ND5 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 5).
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-607 of mouse MT-ND5 (NP_904338.1).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200
Protein Size	67kDa
Route	Synthetic peptide
Manufacturer - Research Area	Cancer, Signal Transduction, Endocrine & Metabolism, Mitochondrial metabolism, Mitochondrial markers, Neuroscience, Neurodegenerative Diseases

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A8135-1000uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time