Stella Rabbit pAb

ArtNr	A20176-50ul
Hersteller	Abclonal
Menge	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Kategorie	Antibodies Western Blot Primary Antibodies
Typ	Antibody Primary
Applikationen	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN
NCBI	Dppa3
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PCG7, PGC7, Stella, 2410075G02Rik
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background	Enables methylated histone binding activity. Involved in negative regulation of DNA demethylation; protection of DNA demethylation of female pronucleus; and regulation of genetic imprinting. Acts upstream of or within embryonic cleavage. Located in cytoplasm; female pronucleus; and male pronucleus. Is expressed in several structures, including central nervous system; early conceptus; gonad; hindgut diverticulum; and primordial germ cell. Orthologous to human DPPA3 (developmental pluripotency associated 3).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Stella (NP_631964.1).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	18kDa
Route	Recombinant protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A20176-50ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ul

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern