Comparison

Stella Rabbit pAb European Partner

Item no. A20176-50ul
Manufacturer Abclonal
Amount 50 ul
Quantity options 1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Category
Type Antibody Primary
Applications WB, ELISA
Specific against Mouse (Murine, Mus musculus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN
NCBI Dppa3
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias PCG7, PGC7, Stella, 2410075G02Rik
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
Enables methylated histone binding activity. Involved in negative regulation of DNA demethylation; protection of DNA demethylation of female pronucleus; and regulation of genetic imprinting. Acts upstream of or within embryonic cleavage. Located in cytoplasm; female pronucleus; and male pronucleus. Is expressed in several structures, including central nervous system; early conceptus; gonad; hindgut diverticulum; and primordial germ cell. Orthologous to human DPPA3 (developmental pluripotency associated 3).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Stella (NP_631964.1).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
18kDa
Route
Recombinant protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close