« Zurück
Startseite /
CD267/TACI Rabbit mAb

CD267/TACI Rabbit mAb

ArtNr	A24921-100uL
Hersteller	Abclonal
Menge	100 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Antibodies Primary Antibodies Antibody
Typ	Antibody Monoclonal
Applikationen	FC
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT
NCBI	Tnfrsf13b
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Taci,1200009E08Rik,CD267/TACI
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	27kDa
Background	Acts upstream of or within B cell homeostasis; hematopoietic progenitor cell differentiation; and negative regulation of B cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in renal vasculature. Used to study systemic lupus erythematosus. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human TNFRSF13B (TNF receptor superfamily member 13B).
Manufacturer - Cross Reactivity	Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 5-129 of mouse CD267/TACI (NP_067324.1).
Recommended Dilution	FC, 1:500 - 1:1000
Protein Size	27kDa
Route	Recombinant Protein
Manufacturer - Research Area	Adaptive immune response, CDs.
Antigen Seq	FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT
Manufacturer - Gene ID (Human)	23495
Expected Protein Size	27kDa
Gene Symbol	Tnfrsf13b

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A24921-100uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 uL

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern