« Back
Home /
CD267/TACI Rabbit mAb

CD267/TACI Rabbit mAb

Item no.	A24921-100uL
Manufacturer	Abclonal
Amount	100 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	FC
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT
NCBI	Tnfrsf13b
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Taci,1200009E08Rik,CD267/TACI
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	27kDa
Background	Acts upstream of or within B cell homeostasis; hematopoietic progenitor cell differentiation; and negative regulation of B cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in renal vasculature. Used to study systemic lupus erythematosus. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human TNFRSF13B (TNF receptor superfamily member 13B).
Manufacturer - Cross Reactivity	Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 5-129 of mouse CD267/TACI (NP_067324.1).
Recommended Dilution	FC, 1:500 - 1:1000
Protein Size	27kDa
Route	Recombinant Protein
Manufacturer - Research Area	Adaptive immune response, CDs.
Antigen Seq	FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT
Manufacturer - Gene ID (Human)	23495
Expected Protein Size	27kDa
Gene Symbol	Tnfrsf13b

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A24921-100uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

available

Delivery expected until 9/11/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer