« Back
Home /
Phospho-SRC Family-Y416 Rabbit mAb

Phospho-SRC Family-Y416 Rabbit mAb

Item no.	AP1370-50uL
Manufacturer	Abclonal
Amount	50 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	TDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGL
NCBI	Src Family
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ASV,SRC1,THC6,c-SRC,p60-Src,SRC,Phospho-SRC Family-Y416
Shipping Condition	Cool pack
Available
Manufacturer - Category	Phosphorylated Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	60kDa
Background	This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic phosphorylated peptide around Y416 of human SRC Family (NP_005408.1).
Recommended Dilution	WB, 1:100 - 1:500
Protein Size	60kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics & Nuclear Signaling, Cancer, Signal Transduction, G protein signaling, G2/M DNA Damage Checkpoint, Kinase, Tyrosine kinases, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology & Developmental Biology, Apoptosis, Inhibition of Apoptosis, Cell Adhesion, Gap Junctions, Cytoskeleton, Microtubules, Actins, Wnt/β-Catenin Signaling Pathway, Immunology & Inflammation, IL-6 Receptor Signaling Pathway, Cardiovascular, Angiogenesis, Protein phosphorylation.
Antigen Seq	NEYTAR
Manufacturer - Gene ID (Human)	2534/3055/3932/4067/6714/7525
Expected Protein Size	60kDa
Gene Symbol	Src Family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

AP1370-50uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 9/11/2025

Compare

Add to wishlist

Get an offer

Request delivery time