« Zurück
Startseite /
Recombinant Human Kallikrein-7(KLK7),partial

Recombinant Human Kallikrein-7(KLK7),partial

ArtNr	CSB-EP012458HU-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNE RWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASK SFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVR LPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVD VKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACN GDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQ VCKFTKWINDTMKKHR
Protein Familie	Peptidase S1 family, Kallikrein subfamily
Citations	Vaspin inhibits kallikrein 7 by serpin mechanism.Heiker J.T., Kloting N., Kovacs P., Kuettner E.B., Strater N., Schultz S., Kern M., Stumvoll M., Bluher M., Beck-Sickinger A.G.Cell. Mol. Life Sci. 70:2569-2583(2013)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Serine protease 6Stratum corneum chymotryptic enzyme ;hSCCE
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	51.7 kDa
General Research Areas	Cancer
Relevance	May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-\|-Gln-15' and insulin B chain at '6-Leu-\|-Cys-7', '16-Tyr-\|-Leu-17', '25-Phe-\|-Tyr-26' and '26-Tyr-\|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
Expression Region	28-253aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-\|-Gln-15' and insulin B chain at '6-Leu-\|-Cys-7', '16-Tyr-\|-Leu-17', '25-Phe-\|-Tyr-26' and '26-Tyr-\|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
Subcellular Location	Secreted
Tissue Specificity	Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up-regulated in ovarian carcinoma, especially late-stage serous carcinoma, compared with normal ovaries and benign adenomas (at protein level).
Gene Names	KLK7
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP012458HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern