« Back
Home /
Recombinant Human Kallikrein-7(KLK7),partial

Recombinant Human Kallikrein-7(KLK7),partial

Item no.	CSB-EP012458HU-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNE RWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASK SFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVR LPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVD VKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACN GDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQ VCKFTKWINDTMKKHR
Protein Family	Peptidase S1 family, Kallikrein subfamily
Citations	Vaspin inhibits kallikrein 7 by serpin mechanism.Heiker J.T., Kloting N., Kovacs P., Kuettner E.B., Strater N., Schultz S., Kern M., Stumvoll M., Bluher M., Beck-Sickinger A.G.Cell. Mol. Life Sci. 70:2569-2583(2013)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Serine protease 6Stratum corneum chymotryptic enzyme ;hSCCE
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	51.7 kDa
General Research Areas	Cancer
Relevance	May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-\|-Gln-15' and insulin B chain at '6-Leu-\|-Cys-7', '16-Tyr-\|-Leu-17', '25-Phe-\|-Tyr-26' and '26-Tyr-\|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
Expression Region	28-253aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-\|-Gln-15' and insulin B chain at '6-Leu-\|-Cys-7', '16-Tyr-\|-Leu-17', '25-Phe-\|-Tyr-26' and '26-Tyr-\|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
Subcellular Location	Secreted
Tissue Specificity	Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up-regulated in ovarian carcinoma, especially late-stage serous carcinoma, compared with normal ovaries and benign adenomas (at protein level).
Gene Names	KLK7
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP012458HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer