« Zurück
Home /
Recombinant Human Membrane-associated phosphatidylinositol transfer protein 1(PITPNM1),partial

Recombinant Human Membrane-associated phosphatidylinositol transfer protein 1(PITPNM1),partial

Hersteller	Cusabio
Kategorie	Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-RP019954h-1
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Transport
Uniprot ID	O00562
Gene Names	PITPNM1
Organism	Homo sapiens (Human)
AA Sequence	MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSG EGSGVEILANRPYTDGPGGSGQYTHKVYHVGSHIP GWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVE KFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDT IDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDD WARTAAQTGPLMCAYKLCKVEFRYWGMQAKIEQFI HDVGLRRVMLRAHRQAWCWQDEWTELSM
Expression Region	1-238aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	54.5 kDa
Alternative Name(s)	Drosophila retinal degeneration B homologPhosphatidylinositol transfer protein, membrane-associated 1 ; PITPnm 1; Pyk2 N-terminal domain-interacting receptor 2 ; NIR-2
Relevance	Regulates RHOA activity, and plays a role in cytoskeleton rodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between mbranes . Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.4 Publications
Reference	Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Regulates RHOA activity, and plays a role in cytoskeleton remodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between membranes (By similarity). Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.
Subcellular Location	Cytoplasm, Golgi apparatus, Golgi stack membrane, Peripheral membrane protein, Endoplasmic reticulum membrane, Peripheral membrane protein, Lipid droplet, Cleavage furrow, Midbody
Protein Families	PtdIns transfer protein family, PI transfer class IIA subfamily
Tissue Specificity	Ubiquitous.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen