« Zurück
Startseite /
Recombinant Human Activator of 90KDA heat shock protein ATPase homolog 1(AHSA1)

Recombinant Human Activator of 90KDA heat shock protein ATPase homolog 1(AHSA1)

ArtNr	CSB-RP054544h-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAKWGEGDPRWIVEERADATNVNNWHWTERDASNW STDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASI NNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEI PNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEG VKLLREAMGIYISTLKTEFTQGMILPTMNGESVDP VGQPALKTEERKAKPAPSKTQARPVGVKIPTCKIT LKETFLTSPEELYRVFTTQELVQAFTHAPATLEAD RGG
Protein Familie	AHA1 family
Citations	Isolation of a novel gene underexpressed in Down syndrome.Michaud J., Chrast R., Rossier C., Papassavas M.P., Antonarakis S.E., Scott H.S.Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. , Zhou J., Xu S.-H., Gu J., Shi J.-X., Jin W.-R., Zhang C.-K., Wu T.-M., Huang G.-Y., Chen Z., Chen M.-D., Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	p38
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	65.3 kDa
General Research Areas	Neuroscience
Relevance	Cochaperone that stimulates HSP90 ATPase activity . May affect a step in the endoplasmic reticulum to Golgi trafficking.
Expression Region	1-338aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a co-chaperone of HSP90AA1. Activates the ATPase activity of HSP90AA1 leading to increase in its chaperone activity. Competes with the inhibitory co-chaperone FNIP1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins
Subcellular Location	Cytoplasm, cytosol, Endoplasmic reticulum
Tissue Specificity	Expressed in numerous tissues, including brain, heart, skeletal muscle and kidney and, at lower levels, liver and placenta.
Gene Names	AHSA1
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern