« Back
Home /
Recombinant Human Activator of 90KDA heat shock protein ATPase homolog 1(AHSA1)

Recombinant Human Activator of 90KDA heat shock protein ATPase homolog 1(AHSA1)

Item no.	CSB-RP054544h-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAKWGEGDPRWIVEERADATNVNNWHWTERDASNW STDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASI NNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEI PNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEG VKLLREAMGIYISTLKTEFTQGMILPTMNGESVDP VGQPALKTEERKAKPAPSKTQARPVGVKIPTCKIT LKETFLTSPEELYRVFTTQELVQAFTHAPATLEAD RGG
Protein Family	AHA1 family
Citations	Isolation of a novel gene underexpressed in Down syndrome.Michaud J., Chrast R., Rossier C., Papassavas M.P., Antonarakis S.E., Scott H.S.Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. , Zhou J., Xu S.-H., Gu J., Shi J.-X., Jin W.-R., Zhang C.-K., Wu T.-M., Huang G.-Y., Chen Z., Chen M.-D., Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	p38
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	65.3 kDa
General Research Areas	Neuroscience
Relevance	Cochaperone that stimulates HSP90 ATPase activity . May affect a step in the endoplasmic reticulum to Golgi trafficking.
Expression Region	1-338aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a co-chaperone of HSP90AA1. Activates the ATPase activity of HSP90AA1 leading to increase in its chaperone activity. Competes with the inhibitory co-chaperone FNIP1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins
Subcellular Location	Cytoplasm, cytosol, Endoplasmic reticulum
Tissue Specificity	Expressed in numerous tissues, including brain, heart, skeletal muscle and kidney and, at lower levels, liver and placenta.
Gene Names	AHSA1
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer