« Zurück
Startseite /
Recombinant Rat Regucalcin(Rgn)

Recombinant Rat Regucalcin(Rgn)

ArtNr	CSB-EP019630RA-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIP SKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYV ATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDG KVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPD HSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTV DAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDV EGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKT TSC
Protein Familie	SMP-30/CGR1 family
Citations	"Senescence marker protein 30 functions as gluconolactonase in L-ascorbic acid biosynthesis, and its knockout mice are prone to scurvy." Kondo Y., Inai Y., Sato Y., Handa S., Kubo S., Shimokado K., Goto S., Nishikimi M., Maruyama N., Ishigami A. Proc. Natl. Acad. Sci. U.S.A. 103:5723-5728(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Gluconolactonase (EC:3.1.1.17); Short name:; GNL; Senescence marker protein 30; Short name:; SMP-30; Smp30
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	51.9 kDa
General Research Areas	Signal Transduction
Relevance	Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca2+ signaling, and Ca2+-dependent cellular processes and enzyme activities.
Expression Region	1-299aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities.
Subcellular Location	Cytoplasm
Tissue Specificity	Detected in liver (at protein level). Hepatocytes and renal proximal tubular epithelium.
Gene Names	Rgn
Sequence Info	Full Length
Organism	Rattus norvegicus (Rat)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP019630RA-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern