ABflo® 594 Rabbit anti-Mouse IgG1 mAb

ABflo® 594. Ex:588nm. Em:604nm.

Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.

Mouse IgG1 is a subtype of immunoglobulin G antibody that is produced by B cells in response to an antigen. It is the most abundant IgG subtype in the serum and plays a crucial role in the adaptive immune response. Mouse IgG1 is composed of two heavy chains and two light chains, and it is involved in opsonization, complement activation, and antibody-dependent cell-mediated cytotoxicity. It is also involved in the regulation of immune responses, including the activation of T cells and the inhibition of B cell activation. Mouse IgG1 is widely used in research and diagnostic applications, including ELISA, Western blotting, and immunohistochemistry. It is also used in therapeutic applications, such as immunotherapy and vaccine development.

Recombinant fusion protein containing a sequence corresponding to amino acids 98-324 of mouse IgG1(P01868).

Recombinant Protein

AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK

Ighg1