Comparison

ABflo® 594 Rabbit anti-Mouse IgG1 mAb European Partner

Item no. A24926-100T
Manufacturer Abclonal
Amount 100 T
Quantity options 100 T 100 ul 200 T 20 ul 500 T
Category
Type Antibody Monoclonal
Applications FC
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Purity Affinity purification
Sequence AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDIT
NCBI Ighg1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias IgG1
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Manufacturer - Conjugate / Tag
ABflo® 594. Ex:594nm. Em:619nm.
Shipping Temperature
ice pack
Storage Conditions
Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight
36kDa
Background
Mouse IgG1 is a subtype of immunoglobulin G antibody that is produced by B cells in response to an antigen. It is the most abundant IgG subtype in the serum and plays a crucial role in the adaptive immune response. Mouse IgG1 is composed of two heavy chains and two light chains, and it is involved in opsonization, complement activation, and antibody-dependent cell-mediated cytotoxicity. It is also involved in the regulation of immune responses, including the activation of T cells and the inhibition of B cell activation. Mouse IgG1 is widely used in research and diagnostic applications, including ELISA, Western blotting, and immunohistochemistry. It is also used in therapeutic applications, such as immunotherapy and vaccine development.
Manufacturer - Cross Reactivity
Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 98-324 of mouse IgG1(P01868).
Recommended Dilution
FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size
35kDa
Route
Recombinant Protein
Manufacturer - Research Area
Immunology Immunoglobulins Heavy Chain IgG.
Antigen Seq
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Expected Protein Size
36kDa
Gene Symbol
Ighg1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 T
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close