Comparison

ABflo® 488 Rabbit anti-Mouse CD16 mAb European Partner

Item no. A24935-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 100 T 100 ul 200 T 20 ul 500 T
Applications FC
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Purity Affinity purification
NCBI Fcgr3
Alias CD16
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Manufacturer - Conjugate / Tag
ABflo® 488. Ex:491nm. Em:516nm.
Shipping Temperature
ice pack
Storage Conditions
Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight
30kDa
Background
Enables IgG binding activity and IgG receptor activity. Acts upstream of or within several processes, including antibody-dependent cellular cytotoxicity; phagocytosis; and positive regulation of hypersensitivity. Located in external side of plasma membrane. Is expressed in liver and spleen. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); dengue disease (multiple); hematologic cancer (multiple); leukopenia (multiple); and malaria (multiple). Orthologous to human FCGR2A (Fc fragment of IgG receptor IIa).
Manufacturer - Cross Reactivity
Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 38-207 of mouse CD16(NP_034318.2).
Protein Size
30kDa
Route
Recombinant Protein
Manufacturer - Research Area
Immunology Inflammation, CDs.
Antigen Seq
LPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNWSSIRSQVQSSYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQD
Manufacturer - Gene ID (Human)
2214/ 2215
Expected Protein Size
30kDa
Gene Symbol
Fcgr3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close