Comparison

α-Synuclein Rabbit mAb European Partner

Item no. A24951-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Applications WB, IF, IP, ICC, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI SNCA
Alias PD1,NACP,PARK1,PARK4,α-Synuclein
Available
Manufacturer - Category
Monoclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
14kDa
Background
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human α-Synuclein(NP_000336.1).
Recommended Dilution
WB, 1:3500 - 1:7000|IF/ICC, 1:200 - 1:800|IP, 0.5μg-4μg antibody for 400μg-800μg extracts of whole cells|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Route
Recombinant protein
Manufacturer - Research Area
Protein phosphorylation, Cell Biology Developmental Biology, Apoptosis, Neuroscience, Neurodegenerative Diseases, Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer's Disease, Dopamine Signaling in Parkinson's Disease, Neurodegenerative Diseases Markers.
Antigen Seq
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Manufacturer - Gene ID (Human)
6622
Expected Protein Size
14kDa
Gene Symbol
SNCA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close