Comparison

Histone H2B Rabbit mAb European Partner

Item no. A26075-100uL
Manufacturer Abclonal
Amount 100 uL
Quantity options 1000 uL 100 uL 20 uL 500 uL
Category
Type Antibody Monoclonal
Applications WB, ELISA, IHC-P, CHIP
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI H2BC21
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias H2B,H2BE,H2BQ,GL105,H2B.1,H2BFQ,H2BGL105,H2B-GL105,HIST2H2BE,Formyl-Histone H2B-K108
Available
Manufacturer - Category
Monoclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3
Protein Weight
14kDa
Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-dependent histone that is a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. The protein has antibacterial and antifungal antimicrobial activity.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human Histone H2B (NP_003519.1).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:2000 - 1:4000|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP, 3 μg antibody for 5μg-10μg of Chromatin
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling.
Antigen Seq
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Manufacturer - Gene ID (Human)
3017/8349
Expected Protein Size
14kDa
Gene Symbol
H2BC21

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close