Comparison

G6PD Rabbit mAb European Partner

Item no. A27296-100uL
Manufacturer Abclonal
Amount 100 uL
Quantity options 1000 uL 100 uL 20 uL 500 uL
Category
Type Antibody Monoclonal
Applications WB, IF, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI G6PD
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias G6PD1
Available
Manufacturer - Category
Monoclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
60kDa
Background
This gene encodes glucose-6-phosphate dehydrogenase. This protein is a cytosolic enzyme encoded by a housekeeping X-linked gene whose main function is to produce NADPH, a key electron donor in the defense against oxidizing agents and in reductive biosynthetic reactions. G6PD is remarkable for its genetic diversity. Many variants of G6PD, mostly produced from missense mutations, have been described with wide ranging levels of enzyme activity and associated clinical symptoms. G6PD deficiency may cause neonatal jaundice, acute hemolysis, or severe chronic non-spherocytic hemolytic anemia. Two transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 416-515 of human G6PD (NP_001035810.1).
Route
Synthetic peptide
Manufacturer - Research Area
Cancer, Signal Transduction, Endocrine Metabolism, Carbohydrate metabolism, Endocrine and metabolic diseases, Diabetes, Cardiovascular, Heart, Cardiovascular diseases, Heart disease.
Antigen Seq
EESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL
Manufacturer - Gene ID (Human)
2539
Expected Protein Size
60kDa
Gene Symbol
G6PD

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close