« Back
Home /
CMTM3 Rabbit pAb

CMTM3 Rabbit pAb

Item no.	A2943-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Applications	WB
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
NCBI	CMTM3
Alias	BNAS2,CKLFSF3,CMTM3
Available
Manufacturer - Category	Polyclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	20kDa
Background	This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants containing different 5' UTRs, but encoding the same protein, have been identified.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-182 of human CMTM3 (NP_653202.1).
Recommended Dilution	WB, 1:500 - 1:1000
Route	Synthetic peptide
Manufacturer - Research Area	Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway.
Antigen Seq	MMDFLRCVTAALIYFAISITAIAKYSDGASKAAGVFGFFATIVFATDFYLIFNDVAKFLKQGDSADETTAHKTEEENSDSDSD
Manufacturer - Gene ID (Human)	123920
Expected Protein Size	20kDa
Gene Symbol	CMTM3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A2943-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/11/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer