« Back
Home /
PGC1 alpha Rabbit pAb

PGC1 alpha Rabbit pAb

Item no.	A17089-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	100 ul 200 ul 20 ul 50 ul
Category	Oncology Metabolism Glucose Homeostasis Antibodies Western Blot Primary Antibodies By Organ Thyroid Cancer
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	MAWDMCSQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYNNEPANIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGAVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHAANHTHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCASKKKSHTQPQSQHAQAKPT
NCBI	Ppargc1a
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PPARGC1A, LEM6, PGC-1(alpha), PGC-1alpha, PGC-1v, PGC1, PGC1A, PPARGC1, PPARG coactivator 1 alpha, PGC1 alpha, Ppargc1a
Available
Manufacturer - Category	Polyclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background	This gene encodes a transcriptional coactivator that induces and coordinates gene expression regulating mitochondrial biogenesis, respiration, hepatic gluconeogenesis, thermogenic program in brown fat and muscle fiber-type switching. Mice lacking the encoded protein exhibit reduced thermogenic capacity, hyperactivity and resistance to diet-induced obesity. Mice lacking the encoded protein specifically in the heart exhibit peripartum cardiomyopathy. Alternative splicing results in multiple transcript variants.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of mouse PGC1 alpha (NP_032930.1).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	91kDa
Route	Recombinant Protein
Manufacturer - Research Area	Epigenetics & Nuclear Signaling, Nuclear Receptor Signaling, Cancer, Signal Transduction, mTOR Signaling Pathway, Cell Biology & Developmental Biology, Endocrine & Metabolism, Mitochondrial metabolism, Mitochondrial Biogenesis, Nucleotide metabolism, Molecular processes, AMPK Signaling Pathway, Endocrine and metabolic diseases, Diabetes, Obesity, Neuroscience, Neurodegenerative Diseases, Cardiovascular, Lipids, Fatty Acids

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A17089-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer