Comparison

PGC1 alpha Rabbit pAb European Partner

Item no. A17089-50ul
Manufacturer Abclonal
Amount 50 ul
Quantity options 100 ul 200 ul 20 ul 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Mouse (Murine, Mus musculus)
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence MAWDMCSQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYNNEPANIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGAVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHAANHTHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCASKKKSHTQPQSQHAQAKPT
NCBI Ppargc1a
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias PPARGC1A, LEM6, PGC-1(alpha), PGC-1alpha, PGC-1v, PGC1, PGC1A, PPARGC1, PPARG coactivator 1 alpha, PGC1 alpha, Ppargc1a
Available
Manufacturer - Category
Polyclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background
This gene encodes a transcriptional coactivator that induces and coordinates gene expression regulating mitochondrial biogenesis, respiration, hepatic gluconeogenesis, thermogenic program in brown fat and muscle fiber-type switching. Mice lacking the encoded protein exhibit reduced thermogenic capacity, hyperactivity and resistance to diet-induced obesity. Mice lacking the encoded protein specifically in the heart exhibit peripartum cardiomyopathy. Alternative splicing results in multiple transcript variants.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of mouse PGC1 alpha (NP_032930.1).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
91kDa
Route
Recombinant Protein
Manufacturer - Research Area
Epigenetics & Nuclear Signaling, Nuclear Receptor Signaling, Cancer, Signal Transduction, mTOR Signaling Pathway, Cell Biology & Developmental Biology, Endocrine & Metabolism, Mitochondrial metabolism, Mitochondrial Biogenesis, Nucleotide metabolism, Molecular processes, AMPK Signaling Pathway, Endocrine and metabolic diseases, Diabetes, Obesity, Neuroscience, Neurodegenerative Diseases, Cardiovascular, Lipids, Fatty Acids

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close