« Back
Home /
RETNLB Rabbit pAb

RETNLB Rabbit pAb

Item no.	A17228-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
NCBI	RETNLB
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	XCP2,FIZZ1,FIZZ2,HXCP2,RELMb,RELMbeta,RELM-beta,RETNLB
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	12kDa
Background	Predicted to enable hormone activity. Involved in epithelial cell proliferation. Predicted to be located in extracellular region. Predicted to be active in extracellular space.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human RETNLB (NP_115968.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	12kDa
Route	Recombinant Protein
Manufacturer - Research Area	Cancer, Cell Biology Developmental Biology, Growth factors.
Antigen Seq	MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Manufacturer - Gene ID (Human)	84666
Expected Protein Size	12kDa
Gene Symbol	RETNLB

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A17228-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 9/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer