Comparison

NF-kB p65/RelA Rabbit pAb European Partner

Item no. A2547-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS
NCBI RELA
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias p65,CMCU,NFKB3,AIF3BL3,NF-kB p65/RelA
Similar products P65
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Protein Weight
60kDa
Background
NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 450-550 of human NF-kB p65/RelA (NP_068810.3).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:100 - 1:500|IF/ICC, 1:50 - 1:200
Protein Size
60kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Protein phosphorylation, Cancer, Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Inhibition of Apoptosis, Death Receptor Signaling Pathway, Endocrine Metabolism, Endocrine and metabolic diseases, Obesity, Immunology Inflammation, B Cell Receptor Signaling Pathway, T Cell Receptor Signaling Pathway, Jak-Stat-IL-6 Receptor Signaling Pathway, NF-kB Signaling Pathway, Toll-like Receptor Signaling Pathway, Neuroscience, Neurodegenerative Diseases, Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer's Disease, Cardiovascular.
Antigen Seq
LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS
Manufacturer - Gene ID (Human)
5970
Expected Protein Size
60kDa
Gene Symbol
RELA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close