« Back
Home /
RAP2B Rabbit pAb

RAP2B Rabbit pAb

Item no.	A4071-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Cell Biology Cytoskeleton Western Blot Primary Antibodies small GTPases Ras Subfamily Rap Subfamily
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
NCBI	RAP2B
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RAP2B
Similar products	RAP2B
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Availability	Inquiry before order
Background	This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human RAP2B (NP_002877.2).
Recommended Dilution	WB, 1:100 - 1:500
Protein Size	21kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, G protein signaling, Small G proteins, Immunology Inflammation, B Cell Receptor Signaling Pathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A4071-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer