Comparison

RAP2B Rabbit pAb European Partner

Item no. A4071-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
NCBI RAP2B
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias RAP2B
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Availability
Inquiry before order
Background
This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human RAP2B (NP_002877.2).
Recommended Dilution
WB, 1:100 - 1:500
Protein Size
21kDa
Route
Recombinant protein
Manufacturer - Research Area
Signal Transduction, G protein signaling, Small G proteins, Immunology Inflammation, B Cell Receptor Signaling Pathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close