Comparison

CCL5 Antibody

Item no. OAAN01406
Manufacturer AVIVA Systems Biology
Amount 50 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Sequence SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias SISd,eoCP,SCYA5,RANTES,TCP228,D17S136E,SIS-delta
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
10 kDa
Manufacturer - Application Additional Information
WB: 1:500~2000
Gene symbol
CCL5
Gene Fullname
C-C motif chemokine ligand 5
Product format
Liquid PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Reconstitution and storage
Store at -20°C. Avoid repeated freeze/thaw cycles.
Description of target
This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms.
Nucleotide accession_num
NM_002985.2
Protein accession_num
NP_002976.2
Protein name
C-C motif chemokine 5
Clonality
Polyclonal
Purification
Affinity purified against immunogen
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 24-91 of human RANTES (NP_002976.2).
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close