Comparison

Anti-Glypican-3 (511~560aa) Antibody

Item no. 131-0067-20
Manufacturer Raybiotech
Amount 20 ug
Quantity options 100 ug 20 ug 200 ug 500 ug
Category
Type Antibody
Applications ELISA
Clone 9A6-B4-G1
Specific against Human (Homo sapiens)
Host Hamster - Armenian
Sequence KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Shipping condition Room temperature
Available
Manufacturer - Applications
ELISA (recommended work dilution = 1:320, 000)
Manufacturer - Category
Antibodies|Primary Antibodies
Shipping Temperature
Ambient temperature
Storage Conditions
-20°C
UNSPSC Code
12352203
Protein Name & Synonyms
Glypican-3 (511~560aa)
Reconstitution
Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml.
Expiration
12 months from the date of shipment when stored properly.
Clonality
Monoclonal
Preparation
Immunogen was polypeptide Glypican-3 (511~560aa)-KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with the immunogen. The IgG fraction of tissue culture supernatant was purified by Protein G/A affinity chromatography.
Western blot
10% SDS-PAGE, Goat anti-mouse HRP: 1:5000.Lane:M: protein marker1: HepG2 cell lysate (10 µl)2: Hela cell lysate (10 µl)3: Mouse Liver lysate (10 µl)StorageThe antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close