« Back
Home /
Mouse anti-Glypican-3 (511~560aa) (9A6-B4-G1)

Mouse anti-Glypican-3 (511~560aa) (9A6-B4-G1)

Manufacturer	Raybiotech
Category	Oncology Neuroscience Neural Signaling Antibodies By Cell Type Blastoma Carcinoma Primary Antibodies
Type	Antibody
Specific against	Human
Clone	9A6-B4-G1
Applications	ELISA
Amount	200 ug
Host	Hamster - Armenian
Item no.	131-0067-200
Targets	GPC1;;GPC3
eClass 6.1	32160702
eClass 9.0	32160702
Available
Application Information	ELISA (recommended work dilution = 1:320, 000)
Protein Name & Synonyms	Glypican-3 (511~560aa)
Reconstitution	Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml.
Expiration	12 months from the date of shipment when stored properly.
Clonality	Monoclonal
Preparation	Immunogen was polypeptide Glypican-3 (511~560aa)-KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with the immunogen. The IgG fraction of tissue culture supernatant was purified by Protein G/A affinity chromatography.
Western Blot	10% SDS-PAGE, Goat anti-mouse HRP: 1:5000.Lane:M: protein marker1: HepG2 cell lysate (10 µl)2: Hela cell lysate (10 µl)3: Mouse Liver lysate (10 µl)StorageThe antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 5/23/2024