Comparison

PLC gamma 1 (PLCG1) Rabbit pAb European Partner

Item no. A16953-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Primary
Applications WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence NSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALF
NCBI PLCG1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias PLC1, NCKAP3, PLC-II, PLC148, PLCgamma1, PLC gamma 1 (PLCG1)
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background
The protein encoded by this gene catalyzes the formation of inositol 1, 4, 5-trisphosphate and diacylglycerol from phosphatidylinositol 4, 5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PLC gamma 1 (PLCG1) (NP_002651.2).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
149kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Protein phosphorylation, Cancer, Signal Transduction, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Cytoskeleton, Actins, Endocrine Metabolism, Lipid Metabolism, Immunology Inflammation, T Cell Receptor Signaling Pathway, Cardiovascular, Angiogenesis, Lipids

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close