Comparison

DEP1 Rabbit pAb European Partner

Item no. A19181-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Primary
Applications WB, ELISA
Specific against Oryza sativa
Host Rabbit
Isotype IgG
Purity Affinity purification
NCBI LOC4347178
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias DN1,DEP1,pay1
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight
45kDa
Background
Guanine nucleotide-binding proteins (G proteins are involved as a modulator or transducer in various transmembrane signaling systems (Probable. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction (Probable. Involved in the regulation of plant architecture, panicle erectness, panicle and grain length, grain weight, and grain yield. Involved in the regulation of grain size.
Manufacturer - Cross Reactivity
Oryza sativa
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of Oryza sativa DEP1. (Q67UU9).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
45kDa
Route
Recombinant protein
Antigen Seq
MGEEAVVMEAPRPKSPPRYPDLCGRRRMQLEVQILSREITFLKDELHFLEGAQPVSRSGCIKEINEFVGTKHDPLIPTKRRRHRSCRLFRWIGSKLCICI
Expected Protein Size
45kDa
Gene Symbol
LOC4347178

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close