« Back
Home /
DEP1 Rabbit pAb

DEP1 Rabbit pAb

Item no.	A19181-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Cell Biology Cytoskeleton Western Blot ELISA Primary Antibodies Intermediate filaments Immunostaining
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Oryza sativa
Isotype	IgG
Purity	Affinity purification
NCBI	LOC4347178
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DN1,DEP1,pay1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	45kDa
Background	Guanine nucleotide-binding proteins (G proteins are involved as a modulator or transducer in various transmembrane signaling systems (Probable. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction (Probable. Involved in the regulation of plant architecture, panicle erectness, panicle and grain length, grain weight, and grain yield. Involved in the regulation of grain size.
Manufacturer - Cross Reactivity	Oryza sativa
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of Oryza sativa DEP1. (Q67UU9).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	45kDa
Route	Recombinant protein
Antigen Seq	MGEEAVVMEAPRPKSPPRYPDLCGRRRMQLEVQILSREITFLKDELHFLEGAQPVSRSGCIKEINEFVGTKHDPLIPTKRRRHRSCRLFRWIGSKLCICI
Expected Protein Size	45kDa
Gene Symbol	LOC4347178

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A19181-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 12/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer