« Back
Home /
Glycerol kinase (GK) Rabbit mAb

Glycerol kinase (GK) Rabbit mAb

Item no.	A19221-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Diabetes Glucose Homeostasis Targets for Rodent Neurosciences Aging & Neurological Disorders Antibodies Primary Antibodies By Organ Lung Cancer Skin Cancer Breast Cancer Bone Cancer Uterine, Ovarian & Cervical Cancer
Type	Antibody Monoclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	IPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP
NCBI	GK
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	GK1,GKD,Glycerol kinase (GK)
Similar products	GK, GK1, GKD, glycerol kinase
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	61kDa
Background	The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 450-559 of human Glycerol kinase (GK) (P32189).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200
Protein Size	61kDa
Route	Synthetic peptide
Manufacturer - Research Area	Cancer, Signal Transduction, Endocrine Metabolism, Lipid Metabolism.
Antigen Seq	IPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP
Manufacturer - Gene ID (Human)	2710
Expected Protein Size	61kDa
Gene Symbol	GK

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A19221-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 10/2/2025

Compare

Add to wishlist

Get an offer

Request delivery time