Comparison

[KD Validated] ATG7 Rabbit mAb European Partner

Item no. A19604-50ul
Manufacturer Abclonal
Amount 50 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, IP, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
NCBI ATG7
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias GSA7, [KD Validated] ATG7
Similar products ATG7, APG7L, APG7-LIKE, GSA7, Apg7/Atg7
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background
This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:50 - 1:200|IP, 1:50 - 1:200
Protein Size
78kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Cancer, Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Autophagy, Ubiquitin, Endocrine Metabolism, Mitochondrial metabolism, Immunology Inflammation, Cardiovascular, Heart

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close