« Back
Home /
β1-Adrenergic Receptor Rabbit pAb

β1-Adrenergic Receptor Rabbit pAb

Item no.	A20818-100uL
Manufacturer	Abclonal
Amount	100 uL
Quantity options	1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	HRELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQGLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAG
NCBI	ADRB1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RHR, B1AR, FNSS2, ADRB1R, BETA1AR, β1-Adrenergic Receptor
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background	The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Beta-1 adrenoceptors are predominately located in the heart. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure.
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human β1-Adrenergic Receptor (NP_000675.1).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	51kDa
Route	Synthetic peptide
Manufacturer - Research Area	Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, Cell Biology Developmental Biology, Growth factors, Neuroscience, Cardiovascular, Blood

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A20818-100uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer