Comparison

β1-Adrenergic Receptor Rabbit pAb European Partner

Item no. A20818-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence HRELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQGLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAG
NCBI ADRB1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias RHR, B1AR, FNSS2, ADRB1R, BETA1AR, β1-Adrenergic Receptor
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Beta-1 adrenoceptors are predominately located in the heart. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human β1-Adrenergic Receptor (NP_000675.1).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
51kDa
Route
Synthetic peptide
Manufacturer - Research Area
Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, Cell Biology Developmental Biology, Growth factors, Neuroscience, Cardiovascular, Blood

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close