Comparison

Integrin-β1/CD29 Rabbit mAb European Partner

Item no. A21220-100uL
Manufacturer Abclonal
Amount 100 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category
Type Antibody Monoclonal
Applications WB, IF, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAI
NCBI ITGB1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias CD29,FNRB,MDF2,VLAB,GPIIA,MSK12,VLA-BETA,Integrin-β1/CD29
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Availability
Inquiry before order
Background
Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene.
Manufacturer - Cross Reactivity
Human, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-728 of human Integrin-β1/CD29 (NP_002202.2).
Recommended Dilution
WB, 1:2000 - 1:10000|IHC-P, 1:1000 - 1:5000|IF/ICC, 1:50 - 1:200
Protein Size
88kDa
Route
Recombinant protein
Manufacturer - Research Area
Signal Transduction, G protein signaling, G-Protein-Coupled Receptors Signaling to MAPK Erk, PI3K-Akt Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Cell Adhesion, Cytoskeleton, Immunology Inflammation, CDs, Neuroscience, Cell Type Marker, Stem Cells, Embryonic Stem Cells, Mesenchymal Stem Cells

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close