Item no. |
A22535-1000uL |
Manufacturer |
Abclonal
|
Amount |
1000 uL |
Quantity options |
1000 uL
100 uL
200 uL
20 uL
500 uL
50 uL
|
Category |
|
Type |
Antibody Polyclonal |
Applications |
WB, ELISA |
Specific against |
Mouse (Murine, Mus musculus) |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
AIKNEGKRKGDEVDGTDEVAKKKSKKGKDKDSSKLEKALKAQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECS |
NCBI |
Parp1 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
PARP, PPOL, ARTD1, Adprp, Adprt1, msPARP, parp-1, sPARP-1, 5830444G22Rik, Cleaved PARP (Asp214) |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Category |
Polyclonal Antibodies |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Background |
Enables NAD+ ADP-ribosyltransferase activity; chromatin binding activity; and protein ADP-ribosylase activity. Involved in negative regulation of telomere maintenance via telomere lengthening; positive regulation of single strand break repair; and voluntary musculoskeletal movement. Acts upstream of or within several processes, including DNA metabolic process; behavioral response to cocaine; and protein poly-ADP-ribosylation. Located in cytoplasm; nucleolus; and nucleoplasm. Part of protein-containing complex. Is expressed in several structures, including Peyer's patch; brain; gut; immune system; and retina. Human ortholog(s) of this gene implicated in several diseases, including arthritis; bacterial meningitis; neurodegenerative disease (multiple); stomach carcinoma; and type 2 diabetes mellitus. Orthologous to human PARP1 (poly(ADP-ribose) polymerase 1). |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 201-300 of Mouse PARP (Asp214) (NP_031441.2). |
Recommended Dilution |
WB, 1:100 - 1:500 |
Protein Size |
113kDa |
Route |
Synthetic peptide |
Manufacturer - Research Area |
Epigenetics & Nuclear Signaling, Chromatin Modifying Enzymes, other, DNA Damage & Repair, RNA Binding, Signal Transduction, Cell Biology & Developmental Biology, Cell Cycle, Centrosome, Death Receptor Signaling Pathway, Immunology & Inflammation, NF-kB Signaling Pathway |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.