Comparison

Bcl-2 Rabbit pAb European Partner

Item no. A25052-100uL
Manufacturer Abclonal
Amount 100 uL
Quantity options 1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Category
Type Antibody Polyclonal
Applications WB, IP, ELISA
Specific against Rat (Rattus norvegicus)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI Bcl-2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Bcl-2,
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
26kDa
Background
Enables BH domain binding activity. Involved in several processes, including response to peptide; response to purine-containing compound; and response to vitamin. Located in cytosol; mitochondrial crista; and perinuclear region of cytoplasm. Used to study several diseases, including brain ischemia (multiple); end stage renal disease; gastric ulcer; intestinal disease (multiple); and status epilepticus. Biomarker of several diseases, including abdominal obesity-metabolic syndrome 1; brain disease (multiple); hypertension (multiple); intrinsic cardiomyopathy (multiple); and neurodegenerative disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including carcinoma (multiple); hematologic cancer (multiple); intracranial aneurysm; prostate cancer; and urinary bladder cancer. Orthologous to human BCL2 (BCL2 apoptosis regulator).
Manufacturer - Cross Reactivity
Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of rat Bcl2(NP_058689.2).
Recommended Dilution
WB, 1:500 - 1:1000|IP, 1:50 - 1:200
Protein Size
26kDa
Route
Recombinant protein
Manufacturer - Research Area
Apoptosis regulation, Autophagy signal transduction, Ddeath receptor signal transduction.
Antigen Seq
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDD
Manufacturer - Gene ID (Human)
596
Expected Protein Size
26kDa
Gene Symbol
Bcl-2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close