Comparison

Pan Cadherin Rabbit mAb European Partner

Item no. A4903-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence IRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
NCBI CDH1/CDH2/CDH3/CDH4
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Arc-1,CD324,CDHE,ECAD,LCAM,UVO,Pan Cadherin
Similar products CD324, CDHE, UVO, Arc-1, ECAD, LCAM
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
140kDa
Background
This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function of this gene is thought to contribute to cancer progression by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. This gene is present in a gene cluster with other members of the cadherin family on chromosome 16. [provided by RefSeq, Nov 2015]
Manufacturer - Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 806-906 of human Cadherin-2 (CDH2) (P19022).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:50 - 1:200
Protein Size
140kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Apoptosis, Calcium Signaling, Cancer, CDs, Cell Adhesion, Cell Adhesion_Cadherins, Cell Adhesion_Tight Junctions, Cell Biology & Developmental Biology, Cell Cycle, Cell Cycle_Centrosome, Cytoskeleton, ErbB-HER Signaling Pathway, Immunology & Inflammation, Invasion and Metastasis, Neuroscience, Signal Transduction, Wnt/β-Catenin Signaling Pathway.
Antigen Seq
IRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Manufacturer - Gene ID (Human)
999/1000/1001/1002
Expected Protein Size
140kDa
Gene Symbol
CDH1/CDH2/CDH3/CDH4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close