Comparison

RPS20 Rabbit mAb European Partner

Item no. A9551-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, IF, IP, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQ
NCBI RPS20
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias S20, uS10, RPS20
Shipping condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S10P family of ribosomal proteins. It is located in the cytoplasm. This gene is co-transcribed with the small nucleolar RNA gene U54, which is located in its second intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two transcript variants encoding different isoforms have been identified for this gene.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPS20 (P60866).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200
Protein Size
13kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, RNA Binding

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close