Item no. |
A9551-500uL |
Manufacturer |
Abclonal
|
Amount |
500 uL |
Quantity options |
1000 uL
100 ul
200 ul
20 ul
500 uL
50 ul
|
Category |
|
Type |
Antibody Monoclonal |
Applications |
WB, IF, IP, ICC, ELISA, IHC-P |
Specific against |
Human (Homo sapiens) |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQ |
NCBI |
RPS20 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
S20, uS10, RPS20 |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Category |
Monoclonal Antibodies |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Background |
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S10P family of ribosomal proteins. It is located in the cytoplasm. This gene is co-transcribed with the small nucleolar RNA gene U54, which is located in its second intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two transcript variants encoding different isoforms have been identified for this gene. |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPS20 (P60866). |
Recommended Dilution |
WB, 1:500 - 1:1000|IHC-P, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200 |
Protein Size |
13kDa |
Route |
Synthetic Peptide |
Manufacturer - Research Area |
Epigenetics Nuclear Signaling, RNA Binding |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.