Comparison

Phospho-SRC Family-Y416 Rabbit mAb European Partner

Item no. AP1370-500uL
Manufacturer Abclonal
Amount 500 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category
Type Antibody Monoclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence TDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGL
NCBI Src Family
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias ASV,SRC1,THC6,c-SRC,p60-Src,SRC,Phospho-SRC Family-Y416
Shipping Condition Cool pack
Available
Manufacturer - Category
Phosphorylated Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
60kDa
Background
This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic phosphorylated peptide around Y416 of human SRC Family (NP_005408.1).
Recommended Dilution
WB, 1:100 - 1:500
Protein Size
60kDa
Route
Synthetic peptide
Manufacturer - Research Area
Epigenetics & Nuclear Signaling, Cancer, Signal Transduction, G protein signaling, G2/M DNA Damage Checkpoint, Kinase, Tyrosine kinases, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology & Developmental Biology, Apoptosis, Inhibition of Apoptosis, Cell Adhesion, Gap Junctions, Cytoskeleton, Microtubules, Actins, Wnt/β-Catenin Signaling Pathway, Immunology & Inflammation, IL-6 Receptor Signaling Pathway, Cardiovascular, Angiogenesis, Protein phosphorylation.
Antigen Seq
NEYTAR
Manufacturer - Gene ID (Human)
2534/3055/3932/4067/6714/7525
Expected Protein Size
60kDa
Gene Symbol
Src Family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 uL
Available: In stock
available

Delivery expected until 9/11/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close