Manufacturer |
Raybiotech
|
Category |
|
Type |
Array |
Specific against |
Human |
Amount |
8 Sample Kit |
Item no. |
PAH-CTLA4-G1-2 |
eClass 6.1 |
32161000 |
eClass 9.0 |
32161000 |
Available |
|
Compatible Sample Types |
Ascites D N A Aptamers Hybridoma cell culture medium Other fluids Plasma Purified antibodies Purified protein Serum |
Method of Detection |
Fluorescence Laser Scanner |
Quantitative/Semi-Quantitative |
Semi-Quantitative |
Solid Support |
Glass Slide |
Gene Symbols |
CTLA4 |
Kit Components |
Ray Bio® human C L T A-4 protein peptide array Blocking Buffer Wash Buffer I Wash Buffer I I Biotin-conjugated secondary antibody Cy3 equivalent dye conjugated streptavidin Array accessories (including slide incubation chamber assembly, gasket, adhesive plastic strips, etc.) |
Other Materials Required |
Distilled water Small plastic boxes or containers Orbital shaker or oscillating rocker Pipettors, pipette tips and other common lab consumables Aluminum foil Laser fluorescence scanner View Compatible Laser Scanners Don't have a compatible scanner? Ray Biotech now offers F R E E scanning service for all Ray Bio glass slide antibody arrays! Learn More |
Synthesized Protein Sequence |
188 amino acids (Lys36-Asn223, without N-terminal signal peptide)KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN |
Protein Name & Synonyms |
CTLA-4 / CD152 |
Application Notes |
Identify high antigenicity epitopes for antibody production & vaccine development Locate (auto)antigen epitopes of (auto)antibodies Define the best antibody clone against the protein-of-interest Perform epitope mutant analysis Map B cell epitopes |
Antibody Type |
Human IgG, mouse IgG, other isotypes (IgA, IgM, IgE, etc.) derived from most animals, upon request. |
Number of Peptides |
177.0 |
Peptide Length |
12-mer |
Peptide Offset |
1-mer |
Array Printing Replicate |
Triplicate |
Service Features |
Small serum sample volume required (2 µl) High density (simultaneously analyze hundreds of overlapping peptides) High sensitivity Large dynamic range Suitable for high-throughput assays High efficiency and accuracy Affordable, quick and simple to use |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.