« Back
Home /
CTLA4 Epitope Mapping Peptide Array

CTLA4 Epitope Mapping Peptide Array

Manufacturer	Raybiotech
Category	Arrays Protein Arrays
Type	Array
Specific against	Human
Amount	16 Sample Kit
Item no.	PAH-CTLA4-G1-4
eClass 6.1	32161000
eClass 9.0	32161000
Available
Compatible Sample Types	Ascites D N A Aptamers Hybridoma cell culture medium Other fluids Plasma Purified antibodies Purified protein Serum
Method of Detection	Fluorescence Laser Scanner
Quantitative/Semi-Quantitative	Semi-Quantitative
Solid Support	Glass Slide
Gene Symbols	CTLA4
Kit Components	Ray Bio® human C L T A-4 protein peptide array Blocking Buffer Wash Buffer I Wash Buffer I I Biotin-conjugated secondary antibody Cy3 equivalent dye conjugated streptavidin Array accessories (including slide incubation chamber assembly, gasket, adhesive plastic strips, etc.)
Other Materials Required	Distilled water Small plastic boxes or containers Orbital shaker or oscillating rocker Pipettors, pipette tips and other common lab consumables Aluminum foil Laser fluorescence scanner View Compatible Laser Scanners Don't have a compatible scanner? Ray Biotech now offers F R E E scanning service for all Ray Bio glass slide antibody arrays! Learn More
Synthesized Protein Sequence	188 amino acids (Lys36-Asn223, without N-terminal signal peptide)KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Protein Name & Synonyms	CTLA-4 / CD152
Application Notes	Identify high antigenicity epitopes for antibody production & vaccine development Locate (auto)antigen epitopes of (auto)antibodies Define the best antibody clone against the protein-of-interest Perform epitope mutant analysis Map B cell epitopes
Antibody Type	Human IgG, mouse IgG, other isotypes (IgA, IgM, IgE, etc.) derived from most animals, upon request.
Number of Peptides	177.0
Peptide Length	12-mer
Peptide Offset	1-mer
Array Printing Replicate	Triplicate
Service Features	Small serum sample volume required (2 µl) High density (simultaneously analyze hundreds of overlapping peptides) High sensitivity Large dynamic range Suitable for high-throughput assays High efficiency and accuracy Affordable, quick and simple to use

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 16 Sample Kit

available

Delivery expected until 6/6/2024